Model Number: animal feed
Brand Name: yatai
Key Specifications/Special Features:
Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitativeandqualitative"andaccordingtotheweather,watertemperature,waterqualityandfeedingadjustfeedingamount,avoidfeedcausestoomuchwaste.Watertemperatureduring20cto30c:3-4times/day;below20c:1-2times/day;Feedrate:3-5%fishweightforstart;1-2%fishweightforgrower;3.Cleartheleftfeedintimetoavoidpollutionwater.Specification;
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
Shipping Information:
- FOB Port: qingdao
- Lead Time: 15 - 20 days
- Dimensions per Unit: 0.8 × 0.5 × 0.8 Meters
- Weight per Unit: 25.1 Kilograms
- Units per Export Carton: 15
- Export Carton Dimensions L/W/H: 5.8 × 2.3 × 2.3 Meters
- Export Carton Weight: 15 Tons (US)
Main Export Markets:
- Asia
- Australasia
- Central/South America
- Eastern Europe
- Mid East/Africa
- North America
- Western Europe



By certification 

